Антинаправленные лизиновые альфа-спирали

Список разделов Альтернативная Физика Уголок Кушелева

Модератор: Kushelev

Сообщение #1 Kushelev » 11.01.2017, 13:44

Пикотехнология белков, ДНК, РНК - 2

http://nanoworld.org.ru/topic/1544/page/32/

https://blast.ncbi.nlm.nih.gov/Blast.cgi

Изображение

Изображение

https://www.ncbi.nlm.nih.gov/protein/530380807?report=genbank&log$=prottop&blast_rank=1&RID=7C0A790J015

PREDICTED: pre-mRNA-splicing factor SLU7 isoform X1 [Homo sapiens]
NCBI Reference Sequence: XP_005265850.1
Identical Proteins FASTA Graphics
Go to:
LOCUS XP_005265850 596 aa linear PRI 06-JUN-2016
DEFINITION PREDICTED: pre-mRNA-splicing factor SLU7 isoform X1 [Homo sapiens].
ACCESSION XP_005265850
VERSION XP_005265850.1
DBLINK BioProject: PRJNA168
DBSOURCE REFSEQ: accession XM_005265793.3
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_000005.10) annotated using gene prediction method: Gnomon,
supported by mRNA and EST evidence.
Also see:
Documentation of NCBI's Annotation Process

##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Homo sapiens Annotation Release 108
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 7.0
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..596
/organism="Homo sapiens"
/db_xref="taxon:9606"
/chromosome="5"
Protein 1..596
/product="pre-mRNA-splicing factor SLU7 isoform X1"
/calculated_mol_wt=69273
Region 171..444
/region_name="Slu7"
/note="Pre-mRNA splicing Prp18-interacting factor;
pfam11708"
/db_xref="CDD:288545"
CDS 1..596
/gene="SLU7"
/gene_synonym="9G8; hSlu7"
/coded_by="XM_005265793.3:473..2263"
/db_xref="GeneID:10569"
/db_xref="HGNC:HGNC:16939"
/db_xref="HPRD:12074"
/db_xref="MIM:605974"
ORIGIN
1 mktsiggqit msatvvdavn aaplsgskem sleepkkmtr edwrkkkele eqrklgnapa
61 evdeegkdin phipqyissv pwyidpskrp tlkhqrpqpe kqkqfsssge wykrgvkens
121 iitkyrkgac encgamthkk kdcferprrv gakftgtnia pdehvqpqlm fdydgkrdrw
181 ngynpeehmk iveeyakvdl akrtlkaqkl qeelasgklv eqanspkhqw geeepnsqme
241 kdhnsedede dkyaddidmp gqnfdskrri tvrnlrired iakylrnldp nsayydpktr
301 amrenpyana gknpdevsya gdnfvrytgd tismaqtqlf aweaydkgse vhlqadptkl
361 ellyksfkvk kedfkeqqke silekyggqe hldappaell laqtedyvey srhgtvikgq
421 eravacskye edvkihnhth iwgsywkegr wgykcchsff kysyctgeag keivnseeci
481 ineitgeesv kkpqtlmelh qeklkeekkk kkkkkkkhrk sssdsddeek kheklkkaln
541 aeearllhvk etmqiderkr pynsmyetre pteeemeayr mkrqrpddpm asflgq
//

Кушелев: Ну вот, наконец начинает проясняться...

ORIGIN
1 mktsiggqit msatvvdavn aaplsgskem sleepkkmtr edwrkkkele eqrklgnapa
61 evdeegkdin phipqyissv pwyidpskrp tlkhqrpqpe kqkqfsssge wykrgvkens
121 iitkyrkgac encgamthkk kdcferprrv gakftgtnia pdehvqpqlm fdydgkrdrw
181 ngynpeehmk iveeyakvdl akrtlkaqkl qeelasgklv eqanspkhqw geeepnsqme
241 kdhnsedede dkyaddidmp gqnfdskrri tvrnlrired iakylrnldp nsayydpktr
301 amrenpyana gknpdevsya gdnfvrytgd tismaqtqlf aweaydkgse vhlqadptkl
361 ellyksfkvk kedfkeqqke silekyggqe hldappaell laqtedyvey srhgtvikgq
421 eravacskye edvkihnhth iwgsywkegr wgykcchsff kysyctgeag keivnseeci
481 ineitgeesv kkpqtlmelh qeklkeekkk kkkkkkkhrk sssdsddeek kheklkkaln
541 aeearllhvk etmqiderkr pynsmyetre pteeemeayr mkrqrpddpm asflgq
//

https://www.ncbi.nlm.nih.gov/nuccore/1034643291

PREDICTED: Homo sapiens SLU7 homolog, splicing factor (SLU7), transcript variant X1, mRNA
NCBI Reference Sequence: XM_005265793.3
FASTA Graphics
Go to:
LOCUS XM_005265793 3907 bp mRNA linear PRI 06-JUN-2016
DEFINITION PREDICTED: Homo sapiens SLU7 homolog, splicing factor (SLU7),
transcript variant X1, mRNA.
ACCESSION XM_005265793
VERSION XM_005265793.3
DBLINK BioProject: PRJNA168
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_000005.10) annotated using gene prediction method: Gnomon,
supported by mRNA and EST evidence.
Also see:
Documentation of NCBI's Annotation Process

On Jun 6, 2016 this sequence version replaced gi:767938029.

##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Homo sapiens Annotation Release 108
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 7.0
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..3907
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="5"
gene 1..3907
/gene="SLU7"
/gene_synonym="9G8; hSlu7"
/note="SLU7 homolog, splicing factor; Derived by automated
computational analysis using gene prediction method:
Gnomon. Supporting evidence includes similarity to: 3
mRNAs, 87 ESTs, 681 long SRA reads, 10 Proteins, and 95%
coverage of the annotated genomic feature by RNAseq
alignments, including 104 samples with support for all
annotated introns"
/db_xref="GeneID:10569"
/db_xref="HGNC:HGNC:16939"
/db_xref="HPRD:12074"
/db_xref="MIM:605974"
CDS 473..2263
/gene="SLU7"
/gene_synonym="9G8; hSlu7"
/codon_start=1
/product="pre-mRNA-splicing factor SLU7 isoform X1"
/protein_id="XP_005265850.1"
/db_xref="GeneID:10569"
/db_xref="HGNC:HGNC:16939"
/db_xref="HPRD:12074"
/db_xref="MIM:605974"
/translation="MKTSIGGQITMSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWR
KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQ
KQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIA
PDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGK
LVEQANSPKHQWGEEEPNSQMEKDHNSEDEDEDKYADDIDMPGQNFDSKRRITVRNLR
IREDIAKYLRNLDPNSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISM
AQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVKKEDFKEQQKESILEKYGGQEHL
DAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGR
WGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELHQEKLKEEK
KKKKKKKKKHRKSSSDSDDEEKKHEKLKKALNAEEARLLHVKETMQIDERKRPYNSMY
ETREPTEEEMEAYRMKRQRPDDPMASFLGQ"
ORIGIN
1 attacgagat tggcttggat tctgtcggat ggacttgggg ctagctgcgg cggggctggg
61 taagaaaata ttgttagaac ttgcgggcga cggggagttg gggaacctga gaaaatgagt
121 cgaaggctcc taattattgg atatatcttc acgggggtga tgagccctca ggtgttgagg
181 gagcgaggac gggggaccga aaagccactg tcctgagacc cattcatggc actcgtgccc
241 tgccaggcca ggcctgcgtc ttcagggaaa cagtcgggat aactatgaga gtgtcgcctt
301 tgtggcggtg cctcgaagac cttgagcaat ccccggactg cgagcaggga aagctgcttc
361 cagtacccaa attgacagac tgtatttcct cgccagaaaa atttacttga gcttcagttt
421 ttcctgttaa gtcgagatga tccgacttca gtggggtatc atgcgggtat aaatgaaaac
481 atctatagga ggccagataa ccatgtcagc cacagttgta gatgcagtta atgctgcacc
541 cctatcgggg tccaaagaaa tgagtttgga agaaccaaag aagatgacca gagaggactg
601 gagaaagaag aaggagctag aagaacagcg aaaattgggc aatgctcctg cagaagttga
661 tgaagaagga aaagacatca acccccatat tcctcagtat atttcttcag tgccatggta
721 tattgatcct tcaaaaagac ctactttaaa acaccagaga ccacaaccag aaaaacaaaa
781 gcagttcagc tcatctggag aatggtacaa gaggggtgta aaagagaatt ccataattac
841 taagtaccgc aaaggagcat gtgaaaattg tggggccatg acacacaaaa agaaagactg
901 ctttgagaga cctaggcgag ttggagccaa atttacaggt actaatatag ctccagatga
961 acatgtccag cctcaactga tgtttgacta tgatgggaag agggatcggt ggaatggcta
1021 caatccagaa gaacacatga aaattgttga agagtatgcc aaagttgatt tggcaaaacg
1081 aacattgaaa gcccagaaac tccaagagga attagcctca ggaaaattag tggaacaggc
1141 taattctcca aaacaccagt ggggagaaga ggaaccaaat tctcagatgg aaaaagatca
1201 taatagtgaa gatgaggatg aagataaata tgcagatgat attgacatgc ctggacagaa
1261 ttttgactcc aagagacgaa ttactgtccg gaatctcagg attcgagaag atattgcaaa
1321 atatttgagg aatttagatc caaattctgc ctactatgat ccaaaaacta gagcaatgag
1381 agagaatcct tatgccaatg caggaaagaa tccagatgaa gtgagttatg ctggagataa
1441 ctttgttagg tacacaggag ataccatttc aatggctcag acacagttgt ttgcatggga
1501 agcctatgac aagggatctg aagtgcatct acaggcagat cctacaaagc tagagctgtt
1561 gtataagtcc ttcaaagtca aaaaagaaga tttcaaagaa cagcagaaag aaagcatcct
1621 ggaaaagtat ggtggccaag aacatttgga tgcccctcca gctgaattgc ttttagccca
1681 gactgaagac tatgtggagt actcaagaca tgggacagtc atcaaaggac aggagcgggc
1741 tgttgcctgc tctaagtatg aggaggatgt gaagatccac aatcacacac atatctgggg
1801 atcgtactgg aaagaaggcc gatggggata caaatgctgt cactcttttt tcaagtattc
1861 ctattgtact ggagaagctg ggaaggagat tgttaactct gaggagtgta ttataaatga
1921 gataactggg gaagaatctg tgaaaaaacc tcaaaccctc atggagctgc atcaagaaaa
1981 actgaaagag gaaaagaaga agaagaaaaa gaaaaagaag aagcatcgaa agagcagttc
2041 agatagtgat gatgaagaaa agaagcatga aaaattgaaa aaggcactga acgcagagga
2101 ggcccgcctt cttcatgtca aggagaccat gcagattgat gagaggaagc ggccttacaa
2161 tagcatgtat gaaactcgag aacctactga agaggaaatg gaggcatata gaatgaaacg
2221 tcagaggcca gatgacccca tggcctcttt ccttggacag tagcaactag tcagaagacc
2281 atccaagata gatgcagctg atacattctt ttcagcttct tattgatgat tgtagataga
2341 aaaatccttg tttattcttc ttgctgcctg gctttaataa atatttcaga tgcctcacag
2401 taagttcact cctttccata ctgaggaaac aagaaaagaa gaagaggcac atgaagtgtg
2461 cttttgggaa tagaatttaa aattggatta agattttatt tccagttttt tttatttatt
2521 tatttttttt tttgagacgg agtcttgctc tgtcgcccag gctgaagtgc ggtggcgcga
2581 tctcggctca ctgcaagctc cacctcccag gttcacgcca ttctcctgcc tcagcctccc
2641 tagtagttgg gactacaggc gcccgccacc atgctcagct aattttttgt atttttagta
2701 gagacggttt catcgtgtta gccaggatgg tctcgatctc ctgaccttgt gatccacccg
2761 cctcagcctc ccaaagtgct gagattacag gcgtgagcca ccgcgcctgg cctatttcca
2821 gttttatgtg agtcatgtaa aaaagccttg gctctctacc tattaagaat gtctctttct
2881 ctgtatttat taagcttcaa actttattgc ttcgattttt gtggccctat atttagtatt
2941 agcacacctt ggttttgaga aaaaaacagg gctttgtttt tttaaataat tactagcaac
3001 tctgtgacta catttatttt tatttttttt agagacagga tcttgctatg ttgcccaggc
3061 tagagagcag tggcttttca cagacaaagt cataatgccc tgcagtcttg ggctcaagcg
3121 attctctctt ccttggcctc tggagtagac taaatgtgtt agtctttgaa tggaaaacaa
3181 ctattttctc atcattgggt caatattgac tgatcagtag taggtctttt accattctgg
3241 acataagtct aggtgtagaa atcctttcct ttatcataga ggatatggtt tacattaccg
3301 tttgttttca ttgtgattgc ccctatgtaa caatcatgaa tattagattt tttaaattgt
3361 agaatatcct aatatttata gccagcagct gttactttgt ttgtaaaatt tgcaaaaaaa
3421 caaaacctga agttggttta ttgaaagaat tataaggata gcttctaggg atattagtaa
3481 tagattgcca tgatcctgaa gcctcttctc agaacactgt gaagataata ctgacagtag
3541 aatcagtgaa aacagcctaa caaaacctct gacatcagta tatcaacttt taacagccca
3601 ctcactggct tttctaaact accaaaaacc acctgtagga tactgcatta agtcagcatc
3661 tcagaaacag tggtgtgagt aactgagtca aattgtcaag tactttggat atacatagtg
3721 tcgagcttta gattggtatg aaattaaaca gcaatgcaaa tagatttaat tcctatttac
3781 tttaagaatg aaaaacaatg ttcattttcc tacctaaaca gggtggttca acataaaggc
3841 tgatgttgtg tccgttttgt attttatctt ttgttaaaga tacataaatg acaatactta
3901 actgtga
//

https://www.ncbi.nlm.nih.gov/nuccore/1034643291?report=fasta

>XM_005265793.3 PREDICTED: Homo sapiens SLU7 homolog, splicing factor (SLU7), transcript variant X1, mRNA
ATTACGAGATTGGCTTGGATTCTGTCGGATGGACTTGGGGCTAGCTGCGGCGGGGCTGGGTAAGAAAATA
TTGTTAGAACTTGCGGGCGACGGGGAGTTGGGGAACCTGAGAAAATGAGTCGAAGGCTCCTAATTATTGG
ATATATCTTCACGGGGGTGATGAGCCCTCAGGTGTTGAGGGAGCGAGGACGGGGGACCGAAAAGCCACTG
TCCTGAGACCCATTCATGGCACTCGTGCCCTGCCAGGCCAGGCCTGCGTCTTCAGGGAAACAGTCGGGAT
AACTATGAGAGTGTCGCCTTTGTGGCGGTGCCTCGAAGACCTTGAGCAATCCCCGGACTGCGAGCAGGGA
AAGCTGCTTCCAGTACCCAAATTGACAGACTGTATTTCCTCGCCAGAAAAATTTACTTGAGCTTCAGTTT
TTCCTGTTAAGTCGAGATGATCCGACTTCAGTGGGGTATCATGCGGGTATAAATGAAAACATCTATAGGA
GGCCAGATAACCATGTCAGCCACAGTTGTAGATGCAGTTAATGCTGCACCCCTATCGGGGTCCAAAGAAA
TGAGTTTGGAAGAACCAAAGAAGATGACCAGAGAGGACTGGAGAAAGAAGAAGGAGCTAGAAGAACAGCG
AAAATTGGGCAATGCTCCTGCAGAAGTTGATGAAGAAGGAAAAGACATCAACCCCCATATTCCTCAGTAT
ATTTCTTCAGTGCCATGGTATATTGATCCTTCAAAAAGACCTACTTTAAAACACCAGAGACCACAACCAG
AAAAACAAAAGCAGTTCAGCTCATCTGGAGAATGGTACAAGAGGGGTGTAAAAGAGAATTCCATAATTAC
TAAGTACCGCAAAGGAGCATGTGAAAATTGTGGGGCCATGACACACAAAAAGAAAGACTGCTTTGAGAGA
CCTAGGCGAGTTGGAGCCAAATTTACAGGTACTAATATAGCTCCAGATGAACATGTCCAGCCTCAACTGA
TGTTTGACTATGATGGGAAGAGGGATCGGTGGAATGGCTACAATCCAGAAGAACACATGAAAATTGTTGA
AGAGTATGCCAAAGTTGATTTGGCAAAACGAACATTGAAAGCCCAGAAACTCCAAGAGGAATTAGCCTCA
GGAAAATTAGTGGAACAGGCTAATTCTCCAAAACACCAGTGGGGAGAAGAGGAACCAAATTCTCAGATGG
AAAAAGATCATAATAGTGAAGATGAGGATGAAGATAAATATGCAGATGATATTGACATGCCTGGACAGAA
TTTTGACTCCAAGAGACGAATTACTGTCCGGAATCTCAGGATTCGAGAAGATATTGCAAAATATTTGAGG
AATTTAGATCCAAATTCTGCCTACTATGATCCAAAAACTAGAGCAATGAGAGAGAATCCTTATGCCAATG
CAGGAAAGAATCCAGATGAAGTGAGTTATGCTGGAGATAACTTTGTTAGGTACACAGGAGATACCATTTC
AATGGCTCAGACACAGTTGTTTGCATGGGAAGCCTATGACAAGGGATCTGAAGTGCATCTACAGGCAGAT
CCTACAAAGCTAGAGCTGTTGTATAAGTCCTTCAAAGTCAAAAAAGAAGATTTCAAAGAACAGCAGAAAG
AAAGCATCCTGGAAAAGTATGGTGGCCAAGAACATTTGGATGCCCCTCCAGCTGAATTGCTTTTAGCCCA
GACTGAAGACTATGTGGAGTACTCAAGACATGGGACAGTCATCAAAGGACAGGAGCGGGCTGTTGCCTGC
TCTAAGTATGAGGAGGATGTGAAGATCCACAATCACACACATATCTGGGGATCGTACTGGAAAGAAGGCC
GATGGGGATACAAATGCTGTCACTCTTTTTTCAAGTATTCCTATTGTACTGGAGAAGCTGGGAAGGAGAT
TGTTAACTCTGAGGAGTGTATTATAAATGAGATAACTGGGGAAGAATCTGTGAAAAAACCTCAAACCCTC
ATGGAGCTGCATCAAGAAAAACTGAAAGAGGAAAAGAAGAAGAAGAAAAAGAAAAAGAAGAAGCATCGAA
AGAGCAGTTCAGATAGTGATGATGAAGAAAAGAAGCATGAAAAATTGAAAAAGGCACTGAACGCAGAGGA
GGCCCGCCTTCTTCATGTCAAGGAGACCATGCAGATTGATGAGAGGAAGCGGCCTTACAATAGCATGTAT
GAAACTCGAGAACCTACTGAAGAGGAAATGGAGGCATATAGAATGAAACGTCAGAGGCCAGATGACCCCA
TGGCCTCTTTCCTTGGACAGTAGCAACTAGTCAGAAGACCATCCAAGATAGATGCAGCTGATACATTCTT
TTCAGCTTCTTATTGATGATTGTAGATAGAAAAATCCTTGTTTATTCTTCTTGCTGCCTGGCTTTAATAA
ATATTTCAGATGCCTCACAGTAAGTTCACTCCTTTCCATACTGAGGAAACAAGAAAAGAAGAAGAGGCAC
ATGAAGTGTGCTTTTGGGAATAGAATTTAAAATTGGATTAAGATTTTATTTCCAGTTTTTTTTATTTATT
TATTTTTTTTTTTGAGACGGAGTCTTGCTCTGTCGCCCAGGCTGAAGTGCGGTGGCGCGATCTCGGCTCA
CTGCAAGCTCCACCTCCCAGGTTCACGCCATTCTCCTGCCTCAGCCTCCCTAGTAGTTGGGACTACAGGC
GCCCGCCACCATGCTCAGCTAATTTTTTGTATTTTTAGTAGAGACGGTTTCATCGTGTTAGCCAGGATGG
TCTCGATCTCCTGACCTTGTGATCCACCCGCCTCAGCCTCCCAAAGTGCTGAGATTACAGGCGTGAGCCA
CCGCGCCTGGCCTATTTCCAGTTTTATGTGAGTCATGTAAAAAAGCCTTGGCTCTCTACCTATTAAGAAT
GTCTCTTTCTCTGTATTTATTAAGCTTCAAACTTTATTGCTTCGATTTTTGTGGCCCTATATTTAGTATT
AGCACACCTTGGTTTTGAGAAAAAAACAGGGCTTTGTTTTTTTAAATAATTACTAGCAACTCTGTGACTA
CATTTATTTTTATTTTTTTTAGAGACAGGATCTTGCTATGTTGCCCAGGCTAGAGAGCAGTGGCTTTTCA
CAGACAAAGTCATAATGCCCTGCAGTCTTGGGCTCAAGCGATTCTCTCTTCCTTGGCCTCTGGAGTAGAC
TAAATGTGTTAGTCTTTGAATGGAAAACAACTATTTTCTCATCATTGGGTCAATATTGACTGATCAGTAG
TAGGTCTTTTACCATTCTGGACATAAGTCTAGGTGTAGAAATCCTTTCCTTTATCATAGAGGATATGGTT
TACATTACCGTTTGTTTTCATTGTGATTGCCCCTATGTAACAATCATGAATATTAGATTTTTTAAATTGT
AGAATATCCTAATATTTATAGCCAGCAGCTGTTACTTTGTTTGTAAAATTTGCAAAAAAACAAAACCTGA
AGTTGGTTTATTGAAAGAATTATAAGGATAGCTTCTAGGGATATTAGTAATAGATTGCCATGATCCTGAA
GCCTCTTCTCAGAACACTGTGAAGATAATACTGACAGTAGAATCAGTGAAAACAGCCTAACAAAACCTCT
GACATCAGTATATCAACTTTTAACAGCCCACTCACTGGCTTTTCTAAACTACCAAAAACCACCTGTAGGA
TACTGCATTAAGTCAGCATCTCAGAAACAGTGGTGTGAGTAACTGAGTCAAATTGTCAAGTACTTTGGAT
ATACATAGTGTCGAGCTTTAGATTGGTATGAAATTAAACAGCAATGCAAATAGATTTAATTCCTATTTAC
TTTAAGAATGAAAAACAATGTTCATTTTCCTACCTAAACAGGGTGGTTCAACATAAAGGCTGATGTTGTG
TCCGTTTTGTATTTTATCTTTTGTTAAAGATACATAAATGACAATACTTAACTGTGA

Формы, механизмы, энергия наномира. Сообщение 84 323

FT CDS 473..2263
attacgagat tggcttggat tctgtcggat ggacttgggg ctagctgcgg cggggctggg
taagaaaata ttgttagaac ttgcgggcga cggggagttg gggaacctga gaaaatgagt
cgaaggctcc taattattgg atatatcttc acgggggtga tgagccctca ggtgttgagg
gagcgaggac gggggaccga aaagccactg tcctgagacc cattcatggc actcgtgccc
tgccaggcca ggcctgcgtc ttcagggaaa cagtcgggat aactatgaga gtgtcgcctt
tgtggcggtg cctcgaagac cttgagcaat ccccggactg cgagcaggga aagctgcttc
cagtacccaa attgacagac tgtatttcct cgccagaaaa atttacttga gcttcagttt
ttcctgttaa gtcgagatga tccgacttca gtggggtatc atgcgggtat aaatgaaaac
atctatagga ggccagataa ccatgtcagc cacagttgta gatgcagtta atgctgcacc
cctatcgggg tccaaagaaa tgagtttgga agaaccaaag aagatgacca gagaggactg
gagaaagaag aaggagctag aagaacagcg aaaattgggc aatgctcctg cagaagttga
tgaagaagga aaagacatca acccccatat tcctcagtat atttcttcag tgccatggta
tattgatcct tcaaaaagac ctactttaaa acaccagaga ccacaaccag aaaaacaaaa
gcagttcagc tcatctggag aatggtacaa gaggggtgta aaagagaatt ccataattac
taagtaccgc aaaggagcat gtgaaaattg tggggccatg acacacaaaa agaaagactg
ctttgagaga cctaggcgag ttggagccaa atttacaggt actaatatag ctccagatga
acatgtccag cctcaactga tgtttgacta tgatgggaag agggatcggt ggaatggcta
caatccagaa gaacacatga aaattgttga agagtatgcc aaagttgatt tggcaaaacg
aacattgaaa gcccagaaac tccaagagga attagcctca ggaaaattag tggaacaggc
taattctcca aaacaccagt ggggagaaga ggaaccaaat tctcagatgg aaaaagatca
taatagtgaa gatgaggatg aagataaata tgcagatgat attgacatgc ctggacagaa
ttttgactcc aagagacgaa ttactgtccg gaatctcagg attcgagaag atattgcaaa
atatttgagg aatttagatc caaattctgc ctactatgat ccaaaaacta gagcaatgag
agagaatcct tatgccaatg caggaaagaa tccagatgaa gtgagttatg ctggagataa
ctttgttagg tacacaggag ataccatttc aatggctcag acacagttgt ttgcatggga
agcctatgac aagggatctg aagtgcatct acaggcagat cctacaaagc tagagctgtt
gtataagtcc ttcaaagtca aaaaagaaga tttcaaagaa cagcagaaag aaagcatcct
ggaaaagtat ggtggccaag aacatttgga tgcccctcca gctgaattgc ttttagccca
gactgaagac tatgtggagt actcaagaca tgggacagtc atcaaaggac aggagcgggc
tgttgcctgc tctaagtatg aggaggatgt gaagatccac aatcacacac atatctgggg
atcgtactgg aaagaaggcc gatggggata caaatgctgt cactcttttt tcaagtattc
ctattgtact ggagaagctg ggaaggagat tgttaactct gaggagtgta ttataaatga
gataactggg gaagaatctg tgaaaaaacc tcaaaccctc atggagctgc atcaagaaaa
actgaaagag gaaaagaaga agaagaaaaa gaaaaagaag aagcatcgaa agagcagttc
agatagtgat gatgaagaaa agaagcatga aaaattgaaa aaggcactga acgcagagga
ggcccgcctt cttcatgtca aggagaccat gcagattgat gagaggaagc ggccttacaa
tagcatgtat gaaactcgag aacctactga agaggaaatg gaggcatata gaatgaaacg
tcagaggcca gatgacccca tggcctcttt ccttggacag tagcaactag tcagaagacc
atccaagata gatgcagctg atacattctt ttcagcttct tattgatgat tgtagataga
aaaatccttg tttattcttc ttgctgcctg gctttaataa atatttcaga tgcctcacag
taagttcact cctttccata ctgaggaaac aagaaaagaa gaagaggcac atgaagtgtg
cttttgggaa tagaatttaa aattggatta agattttatt tccagttttt tttatttatt
tatttttttt tttgagacgg agtcttgctc tgtcgcccag gctgaagtgc ggtggcgcga
tctcggctca ctgcaagctc cacctcccag gttcacgcca ttctcctgcc tcagcctccc
tagtagttgg gactacaggc gcccgccacc atgctcagct aattttttgt atttttagta
gagacggttt catcgtgtta gccaggatgg tctcgatctc ctgaccttgt gatccacccg
cctcagcctc ccaaagtgct gagattacag gcgtgagcca ccgcgcctgg cctatttcca
gttttatgtg agtcatgtaa aaaagccttg gctctctacc tattaagaat gtctctttct
ctgtatttat taagcttcaa actttattgc ttcgattttt gtggccctat atttagtatt
agcacacctt ggttttgaga aaaaaacagg gctttgtttt tttaaataat tactagcaac
tctgtgacta catttatttt tatttttttt agagacagga tcttgctatg ttgcccaggc
tagagagcag tggcttttca cagacaaagt cataatgccc tgcagtcttg ggctcaagcg
attctctctt ccttggcctc tggagtagac taaatgtgtt agtctttgaa tggaaaacaa
ctattttctc atcattgggt caatattgac tgatcagtag taggtctttt accattctgg
acataagtct aggtgtagaa atcctttcct ttatcataga ggatatggtt tacattaccg
tttgttttca ttgtgattgc ccctatgtaa caatcatgaa tattagattt tttaaattgt
agaatatcct aatatttata gccagcagct gttactttgt ttgtaaaatt tgcaaaaaaa
caaaacctga agttggttta ttgaaagaat tataaggata gcttctaggg atattagtaa
tagattgcca tgatcctgaa gcctcttctc agaacactgt gaagataata ctgacagtag
aatcagtgaa aacagcctaa caaaacctct gacatcagta tatcaacttt taacagccca
ctcactggct tttctaaact accaaaaacc acctgtagga tactgcatta agtcagcatc
tcagaaacag tggtgtgagt aactgagtca aattgtcaag tactttggat atacatagtg
tcgagcttta gattggtatg aaattaaaca gcaatgcaaa tagatttaat tcctatttac
tttaagaatg aaaaacaatg ttcattttcc tacctaaaca gggtggttca acataaaggc
tgatgttgtg tccgttttgt attttatctt ttgttaaaga tacataaatg acaatactta
actgtga
//

Композиционный код:

1,3,2,3,2,2,1,1,2,1,1,2,1,2,3,2,3,2,3,3,3,2,1,2,4,4,1,3,3,1,3,1,3,3,2,1,1,1,1,3,1,1,1,3,1,1,1,1,2,3,3,1,2,3,1,1,3,
3,3,2,3,3,3,3,3,2,3,1,1,1,1,3,3,3,1,3,3,3,2,4,2,1,3,3,3,3,2,3,3,3,3,3,3,1,1,3,2,3,2,3,3,3,1,1,1,1,2,3,2,3,1,1,1,1,
3,2,3,1,3,1,2,3,3,1,1,1,3,2,2,3,3,3,3,4,1,1,2,1,3,1,3,1,1,3,1,3,3,1,2,3,2,1,3,3,2,3,3,3,2,3,2,3,3,3,1,1,3,3,4,1,3,
1,3,3,4,1,1,3,4,1,3,1,1,3,2,3,3,1,1,3,3,3,3,1,3,1,3,3,3,1,2,3,2,2,1,3,1,1,3,1,3,1,3,3,1,2,2,3,3,4,3,1,3,3,3,2,3,1,
1,1,2,3,1,3,2,3,3,1,1,3,3,3,3,3,3,3,3,1,3,3,3,3,3,2,3,3,3,1,1,3,2,1,3,3,1,1,1,3,2,3,3,1,4,3,1,1,3,2,3,3,3,2,3,3,1,
1,3,3,3,2,3,3,1,1,3,3,2,3,3,3,2,1,3,1,3,3,3,1,3,2,2,1,3,2,3,3,4,3,3,3,2,3,1,3,3,1,1,2,2,3,1,3,2,1,3,1,2,1,1,3,2,1,
3,1,3,1,1,2,3,3,4,3,2,1,2,3,3,2,1,2,1,4,1,3,1,1,1,3,1,3,3,3,3,1,3,3,1,1,3,3,1,1,4,3,1,3,3,1,3,3,3,1,3,1,3,2,3,3,1,
3,3,1,1,3,3,1,3,4,1,1,2,3,3,4,2,1,1,3,2,1,1,4,3,3,1,1,3,1,3,1,1,3,4,1,1,1,3,1,2,3,1,1,2,4,1,1,3,3,1,2,1,2,1,3,1,3,
1,3,3,1,1,3,1,3,3,3,2,3,3,4,1,1,3,3,1,3,1,1,3,3,2,3,1,2,3,4,3,3,3,4,3,3,3,3,1,1,1,1,4,3,3,3,3,4,3,1,3,1,1,1,1,3,1,
3,1,1,1,3,2,1,1,3,2,3,3,3,3,3,3,1,1,3,3,3,1,3,1,2,4,1,2,1,1,1,1,3,3,3,1,1,1,1,1,1,3,3,1,1,1,4,3,1,3,1,1,3,3,3,2,3,
3,3,3,1,3,1,1,2,3,3,1,3,3,1,1,2,3,1,1,1,1,3,1,3,2,1

Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/243369/158289418.3bd/0_170108_e4f1e361_orig.gif

Изображение
В этом белке лизин образует два противонаправленных участка альфа-спирали!
Kushelev M
Автор темы
Аватара
Откуда: г.Дмитров
Репутация: -204
Сообщения: 3307
Темы: 233
С нами: 1 год 11 месяцев

Вернуться в Уголок Кушелева

Кто сейчас на форуме (по активности за 5 минут)

Сейчас этот раздел просматривают: 1 гость

cron